PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004402m
Common NameEUTSA_v10004402mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 381aa    MW: 42742.6 Da    PI: 7.3278
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004402mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.52.3e-26195248155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k r++W+ eLH++F +av++L G+ekA+Pk+ilelm+v+gL++e+v+SHLQkYRl
  Thhalv10004402m 195 KSRVVWSIELHQQFASAVNHL-GIEKAVPKRILELMNVPGLSRENVASHLQKYRL 248
                      68*******************.********************************8 PP

2Response_reg761.4e-25131211109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+ + +++l+q+l +  y +v+ +++++ al++l+e++  +Dl+l D+ mpgm+G++ll++   e  +lp+i+++  g  +++ + ++ 
  Thhalv10004402m  13 VLVVDDDTSCLRILEQMLLRLMY-QVTICSQADVALNILRERKgcFDLVLSDVHMPGMNGYKLLQQVGLEM-DLPVIMMSVDGRTTTVMKGINH 104
                      89*********************.*******************************************6644.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ peel +
  Thhalv10004402m 105 GACDYLIKPIRPEELKN 121
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.8E-1451377IPR017053Response regulator B-type, plant
SuperFamilySSF521725.98E-369146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.4E-4210150No hitNo description
SMARTSM004485.5E-3011123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.41612127IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.7E-2313121IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.47E-2814126No hitNo description
PROSITE profilePS512949.442192251IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-27192253IPR009057Homeodomain-like
SuperFamilySSF466896.81E-18193252IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23195248IPR006447Myb domain, plants
PfamPF002491.5E-6197247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MTISDQFPSG LRVLVVDDDT SCLRILEQML LRLMYQVTIC SQADVALNIL RERKGCFDLV  60
LSDVHMPGMN GYKLLQQVGL EMDLPVIMMS VDGRTTTVMK GINHGACDYL IKPIRPEELK  120
NIWQHVVRRK WTMNKELQRN SQALEDNKNS SSSLETVFSV SECSEESKLR KNKRRVDRED  180
NEEDDLLDPG NNSKKSRVVW SIELHQQFAS AVNHLGIEKA VPKRILELMN VPGLSRENVA  240
SHLQKYRLYL RRLSGGVASQ IRDTESMERY ENIQALVSSG QIPPQTLAAL FGRPVDNHMS  300
GGFGVWTPSG GSQNGNFSID VSSSSMAVVH GLSSSANLRQ QCDGFKSNKG MDHMSMKNLG  360
SWKGLQDSER IIDNEHHGWL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-21194254464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00098PBMTransfer from AT2G01760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532220.0AK353222.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-38-P04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395852.10.0hypothetical protein EUTSA_v10004402mg
SwissprotQ8L9Y30.0ARR14_ARATH; Two-component response regulator ARR14
TrEMBLE4MXH50.0E4MXH5_EUTHA; mRNA, clone: RTFL01-38-P04
TrEMBLV4L0A20.0V4L0A2_EUTSA; Uncharacterized protein
STRINGscaffold_500093.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81502736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.11e-175response regulator 14